Diffuse panbronchiolitis critical region protein 1 (DPCR1) Rabbit Polyclonal Antibody

SKU TA342095

Rabbit Polyclonal Anti-DPCR1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPCR1 antibody: synthetic peptide directed towards the C terminal of human DPCR1. Synthetic peptide located within the following region: SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: diffuse panbronchiolitis critical region 1
• Database Link:
  NP_543146
  Q3MIW9
• Background: The exact function of DPCR1 remains unknown.
• Synonyms: PBLT
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane