FCRL1 Rabbit Polyclonal Antibody

CAT#: TA342077

Rabbit Polyclonal Anti-FCRL1 Antibody

Product Images

WB Suggested Anti-FCRL1 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FCRL1 antibody: synthetic peptide directed towards the N terminal of human FCRL1. Synthetic peptide located within the following region: MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: Fc receptor like 1
• Database Link:
  NP_443170
  Entrez Gene 115350 Human
  UniProt ID Q96LA6
• Background: FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation.
• Synonyms: CD307a; FCRH1; IFGP1; IRTA5
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Horse: 83%; Mouse: 77%

Reference Data

• Protein Families: Transmembrane