MMEL1 Rabbit Polyclonal Antibody

SKU TA342060

Rabbit Polyclonal Anti-MMEL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MMEL1 antibody: synthetic peptide directed towards the middle region of human MMEL1. Synthetic peptide located within the following region: EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 88 kDa
• Gene Name: membrane metallo-endopeptidase-like 1
• Database Link:
  NP_258428
  Q495T6
• Background: MMEL1 is a member ofThe neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis. MMEL1 is a type II transmembrane protein and is thought to be expressed as a secreted protein.The protein encoded byThis gene is a member ofThe neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis.This protein is a type II transmembrane protein and is thought to be expressed as a secreted protein.This gene is expressed mainly in testis with weak expression inThe brain, kidney, and heart.
• Synonyms: MMEL2; NEP2; NEPII; NL1; NL2; SEP
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein, Transmembrane