OriGene Logo

RHBDL2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342040
Rabbit Polyclonal Anti-RHBDL2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY413530 Transient overexpression lysate of rhomboid, veinlet-like 2 (Drosophila) (RHBDL2) 100 ug
$436.00

View other "RHBDL2 or NM_017821" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RHBDL2 antibody: synthetic peptide directed towards the N terminal of human RHBDL2. Synthetic peptide located within the following region: KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name rhomboid like 2
Database Link
Background The protein encoded byThis gene is a member ofThe rhomboid family of integral membrane proteins.This family contains proteins that are related to Drosophila rhomboid protein. Members ofThis family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases.The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. provided by RefSeq, Jul 2008
Synonyms RRP2
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Rat: 85%; Bovine: 79%
Reference Data
Protein Categories Enzyme: Peptidases, Growth Factors, Membrane Proteins
Protein Families Protease, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.