A4GALT Rabbit Polyclonal Antibody

CAT#: TA342029

Rabbit Polyclonal Anti-A4GALT Antibody


 Product Datasheet for 'TA342029'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Clone Name Polyclonal
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Predicted Protein Size 40 kDa
Gene Name alpha 1,4-galactosyltransferase
Background The protein encoded byThis gene catalyzesThe transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified asThe P(k) antigen ofThe P blood group system.The encoded protein, which is a type II membrane protein found inThe Golgi, is also required forThe synthesis ofThe bacterial verotoxins receptor. [provided by RefSeq, Jul 2008]
Synonyms A14GALT; A4GALT1; Gb3S; P(k); P1; P1PK; PK
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - globo series, Metabolic pathways
Other products for "A4GALT"
Frequently bought together (2)
Transient overexpression lysate of alpha 1,4-galactosyltransferase (A4GALT)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones