SUN2 Rabbit Polyclonal Antibody

SKU
TA341972
Rabbit Polyclonal Anti-UNC84B Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-UNC84B antibody: synthetic peptide directed towards the N terminal of human UNC84B. Synthetic peptide located within the following region: SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 80 kDa
Gene Name Sad1 and UNC84 domain containing 2
Database Link
Background SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' acrossThe nuclear envelope, known asThe LINC complex, via interaction withThe conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located inThe outer nuclear membrane (ONM).The LINC complex provides a direct connection betweenThe nuclear lamina andThe cytoskeleton, which contributes to nuclear positioning and cellular rigidity (summary by Haque et al., 2010 PubMed 19933576). supplied by OMIM, Nov 2010. Transcript Variant:This variant (1) representsThe longest transcript and encodesThe longer isoform (a). Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC094797.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025087, ERS025093 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms UNC84B
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.