SUN2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-UNC84B antibody: synthetic peptide directed towards the N terminal of human UNC84B. Synthetic peptide located within the following region: SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 80 kDa |
| Gene Name | Sad1 and UNC84 domain containing 2 |
| Database Link | |
| Background | SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' acrossThe nuclear envelope, known asThe LINC complex, via interaction withThe conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located inThe outer nuclear membrane (ONM).The LINC complex provides a direct connection betweenThe nuclear lamina andThe cytoskeleton, which contributes to nuclear positioning and cellular rigidity (summary by Haque et al., 2010 PubMed 19933576). supplied by OMIM, Nov 2010. Transcript Variant:This variant (1) representsThe longest transcript and encodesThe longer isoform (a). Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC094797.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025087, ERS025093 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end. |
| Synonyms | UNC84B |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.