LRRC8B Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-LRRC8B antibody: synthetic peptide directed towards the N terminal of human LRRC8B. Synthetic peptide located within the following region: PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 92 kDa |
| Gene Name | leucine-rich repeat containing 8 family member B |
| Database Link | |
| Background | Component ofThe volume-regulated anion channel (VRAC, also named VSOAC channel), an anion channel required to maintain a constant cell volume in response to extracellular or intracellular osmotic changes.The VRAC channel conducts iodide better than chloride and may also conduct organic osmolytes like taurine. It is unclear whether LRRC8B constitutes a pore-forming subunit or whether it is closely associated withThe pore. |
| Synonyms | TA-LRRP; TALRRP |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
