Thrb Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB, ChIP |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the n terminal of mouse Thrb. Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 54 |
| Gene Name | thyroid hormone receptor beta |
| Database Link | |
| Background | Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine. |
| Synonyms | ERBA-BETA; ERBA2; GRTH; MGC126109; MGC126110; NR1A2; OTTHUMP00000208475; OTTHUMP00000208531; PRTH; THR1; THRB1; THRB2 |
| Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 86% |
| Reference Data | |
| Protein Categories | Endocrine and metabolic diseases, Intracellular Proteins, Transciption Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.