OriGene Logo

Tcea2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341817
Rabbit Polyclonal Anti-Tcea2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Tcea2 or NM_009326" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Tcea2 antibody is: synthetic peptide directed towards the middle region of Rat Tcea2. Synthetic peptide located within the following region: SVNALRKQSSDEELIALAKSLIKSWKKLLDVSDGKSRDQGRGTPLPTSSS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name transcription elongation factor A (SII), 2
Database Link
Background SII class transcription elongation factor; releases RNA polmerase II ternary complexes from transcriptional arrest at arresting sites; necessary for RNA polymerase II transcription elongation RGD, Feb 2006. ##Evidence-Data-START## Transcript exon combination :: D12927.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS160522, ERS160537 ECO:0000348 ##Evidence-Data-END##
Synonyms OTTHUMP00000031638; TFIIS
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 93%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.