Ciita Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 119 kDa |
| Gene Name | class II transactivator |
| Database Link | |
| Background | Essential for transcriptional activity ofThe HLA class II promoter; activation is viaThe proximal promoter. No DNA binding of in vitro translated CIITA was detected. May act in a coactivator-like fashion through protein-protein interactions by contacting factors binding toThe proximal MHC class II promoter, to elements ofThe transcription machinery, or both. Alternatively it may activate HLA class II transcription by modifying proteins that bind toThe MHC class II promoter. Also mediates enhanced MHC class I transcription,The promoter element requirements for CIITA-mediated transcription are distinct from those of constitutive MHC class I transcription, and CIITA can functionally replace TAF1 atThese genes. Exhibits intrinsic GTP-stimulated acetyltransferase activity. Exhibits serine/threonine protein kinase activity: phosphorylatesThe TFIID component TAF7,The RAP74 subunit ofThe general transcription factor TFIIF, histone H2B at 'Ser-37' and other histones. |
| Synonyms | C2TA; CIITAIV; MHC2TA; NLRA |
| Note | Immunogen Sequence Homology: Dog: 100%; Mouse: 100%; Rat: 93%; Human: 79% |
| Reference Data | |
| Protein Categories | Allergies and autoimmune diseases, Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
