GJC1 (GJD3) Rabbit Polyclonal Antibody

SKU
TA341675
Rabbit Polyclonal Anti-GJC1 Antibody
  $525.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the N terminal of human GJC1. Synthetic peptide located within the following region: IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name gap junction protein delta 3
Database Link
Background This gene is a member ofThe large family of connexins that are required forThe formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, onThe cell surface.This connexon can interact with a connexon from a neighboring cell, thus forming a channel linkingThe cytoplasm ofThe 2 cells. provided by RefSeq, Jul 2008
Synonyms Cx30.2; CX31.9; GJA11; GJC1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Horse: 86%
Reference Data
Protein Categories Membrane Proteins
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.