DHX57 Rabbit Polyclonal Antibody

SKU TA341635

Rabbit Polyclonal Anti-DHX57 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHX57 antibody: synthetic peptide directed towards the C terminal of human DHX57. Synthetic peptide located within the following region: LSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 155 kDa
• Gene Name: DEAH-box helicase 57
• Database Link:
  NP_945314
  Q6P158
• Background: Probable ATP-binding RNA helicase.
• Synonyms: DDX57
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 87%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome