EIF4A3 Rabbit Polyclonal Antibody

CAT#: TA341592

Rabbit Polyclonal Anti-DDX48 Antibody

Product Images

WB Suggested Anti-DDX48 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysateEIF4A3 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX48 antibody: synthetic peptide directed towards the middle region of human DDX48. Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: eukaryotic translation initiation factor 4A3
• Database Link:
  NP_055555
  Entrez Gene 9775 Human
  UniProt ID P38919
• Background: This gene encodes a member ofThe DEAD box protein family. DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The protein encoded byThis gene is a nuclear matrix protein. Its amino acid sequence is highly similar toThe amino acid sequences ofThe translation initiation factors eIF4AI and eIF4AII, two other members ofThe DEAD box protein family. [provided by RefSeq, Jul 2008]
• Synonyms: DDX48; eIF4AIII; MUK34; NMP265; NUK34; RCPS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome