ZNF300 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZNF300 antibody: synthetic peptide directed towards the N terminal of human ZNF300. Synthetic peptide located within the following region: DISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 69 kDa |
| Gene Name | zinc finger protein 300 |
| Database Link | |
| Background | The protein encoded byThis gene is a C2H2-type zinc finger DNA binding protein and likely transcriptional regulator.The function ofThis protein is not yet known. Three transcript variants encoding different isoforms have been found forThis gene. provided by RefSeq, Mar 2010 |
| Synonyms | DKFZp686B24204 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 92%; Horse: 79% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Transciption Factors |
| Protein Families | Transcription Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
