ZNF300 Rabbit Polyclonal Antibody

SKU TA341437

Rabbit Polyclonal Anti-ZNF300 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF300 antibody: synthetic peptide directed towards the N terminal of human ZNF300. Synthetic peptide located within the following region: DISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: zinc finger protein 300
• Database Link:
  NP_443092
  Q96RE9
• Background: The protein encoded byThis gene is a C2H2-type zinc finger DNA binding protein and likely transcriptional regulator.The function ofThis protein is not yet known. Three transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2010]
• Synonyms: DKFZp686B24204
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 92%; Horse: 79%

Reference Data

• Protein Families: Transcription Factors