OriGene Logo

Phostensin (PPP1R18) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340277
Rabbit Polyclonal Anti-PPP1R18 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY408806 Transient overexpression lysate of KIAA1949 (KIAA1949), transcript variant 1 100 ug
$665.00

View other "Phostensin or NM_133471" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PPP1R18 antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1R18. Synthetic peptide located within the following region: PEDAGTGGLRQQEEEAVELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 68 kDa
Gene Name protein phosphatase 1 regulatory subunit 18
Database Link
Background Protein phosphatase-1 interacts with regulatory subunits that target the enzyme to different cellular locations and change its activity toward specific substrates. Phostensin is a regulatory subunit that targets PP1 to F-actin cytoskeleton.
Synonyms HKMT1098; KIAA1949
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 86%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.