Cfdp1 Rabbit Polyclonal Antibody

SKU TA340097

Rabbit Polyclonal Anti-Cfdp1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Cfdp1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cfdp1. Synthetic peptide located within the following region: STLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLERVDHRQFEI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: craniofacial development protein 1
• Database Link:
  NP_955410
  Q75UQ2
• Background: Mouse homolog is involved in embryogenesis and craniofacial development.
• Synonyms: BCNT; BUCENTAUR; CP27; p97; SWC5; Yeti
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data