PYHIN1 Rabbit Polyclonal Antibody

CAT#: TA339836

Rabbit Polyclonal Anti-PYHIN1 Antibody

Product Images

WB Suggested Anti-PYHIN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PYHIN1 antibody: synthetic peptide directed towards the N terminal of human PYHIN1. Synthetic peptide located within the following region: ANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: pyrin and HIN domain family member 1
• Database Link:
  NP_689714
  Entrez Gene 149628 Human
  UniProt ID Q6K0P9
• Background: PYHIN1 belongs to the HIN-200 family. This protein is major mediator of the tumor suppressor activity of IFN in breast cancer cells. It promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization, and HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells.
• Synonyms: IFIX
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 91%; Horse: 91%; Bovine: 91%; Pig: 85%; Rat: 85%