PYHIN1 Rabbit Polyclonal Antibody

CAT#: TA339836

Reviews ()
Write a review

Rabbit Polyclonal Anti-PYHIN1 Antibody



USD 396.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PYHIN1 antibody: synthetic peptide directed towards the N terminal of human PYHIN1. Synthetic peptide located within the following region: ANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name pyrin and HIN domain family member 1
Background PYHIN1 belongs to the HIN-200 family. This protein is major mediator of the tumor suppressor activity of IFN in breast cancer cells. It promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization, and HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells.
Synonyms IFIX
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 91%; Horse: 91%; Bovine: 91%; Pig: 85%; Rat: 85%
Reference Data
Other products for "PYHIN1"
Frequently bought together (2)
Transient overexpression lysate of pyrin and HIN domain family, member 1 (PYHIN1), transcript variant a1
    • 100 ug

USD 605.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 186.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies