OriGene Logo

ZNF714 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339828
Rabbit Polyclonal Anti-ZNF714 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "ZNF714 or NM_182515" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF714 antibody: synthetic peptide directed towards the N terminal of human ZNF714. Synthetic peptide located within the following region: NVMLENYKNLVFLAGIAVSKQDPITSLEQEKEPWNMKICEMVDESPAMCS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 64 kDa
Gene Name zinc finger protein 714
Database Link
Background ZNF714 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Synonyms DKFZp547O168; FLJ33668; FLJ43674
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.