DNER Rabbit Polyclonal Antibody

SKU
TA339792
Rabbit Polyclonal Anti-DNER Antibody
  $515.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DNER antibody: synthetic peptide directed towards the middle region of human DNER. Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 50 kDa
Gene Name delta/notch like EGF repeat containing
Database Link
Background DNER is an activator of the NOTCH1 pathway. It may mediate neuron-glia interaction during astrocytogenesis.
Synonyms bet; UNQ26
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Categories Growth Factors, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.