C19orf2 (URI1) Rabbit Polyclonal Antibody

CAT#: TA339790

Rabbit Polyclonal Anti-URI1 Antibody

Product Images

WB Suggested Anti-URI1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

• 

  Host: Rabbit; Target Name: URI1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: URI1; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in HeLa

• 

  Host: Rabbit; Target Name: URI1; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in HepG2

• 

  Host: Rabbit; Target Name: URI1; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that URI1 is expressed in MCF7

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C19orf2 antibody: synthetic peptide directed towards the middle region of human C19orf2. Synthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: URI1 prefoldin-like chaperone
• Database Link:
  NP_604431
  Entrez Gene 8725 Human
  UniProt ID O94763
• Background: The function of the C19orf2 protein remains unknown.The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Synonyms: FLJ10575; NNX3; RMP; URI
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Rat: 80%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors