OriGene Logo

DUX1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339451
Rabbit Polyclonal Anti-DUX1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415934 Transient overexpression lysate of double homeobox, 1 (DUX1) 100 ug
$436.00

View other "DUX1 or NM_012146" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DUX1 antibody is: synthetic peptide directed towards the N-terminal region of Human DUX1. Synthetic peptide located within the following region: QSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 19 kDa
Gene Name double homeobox 1
Database Link
Background The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX1, resides within these 3.3-kb repeated elements (Beckers et al., 2001 PubMed 11245978). See DUX4 (MIM 606009). supplied by OMIM, Mar 2008. ##Evidence-Data-START## Transcript exon combination :: AJ001481.1 ECO:0000332 ##Evidence-Data-END##
Synonyms 1; double homeobox
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.