OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TM4SF3 (TSPAN8) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339425
Rabbit Polyclonal Anti-TSPAN8 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "TM4SF3 or NM_004616" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TSPAN8 antibody: synthetic peptide directed towards the middle region of human TSPAN8. Synthetic peptide located within the following region: VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 26 kDa
Gene Name tetraspanin 8
Database Link
Background The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene. provided by RefSeq, Jul 2008
Synonyms CO-029; TM4SF3
Note Immunogen Sequence Homology: Human: 100%; Mouse: 82%; Pig: 75%; Guinea pig: 75%
Reference Data
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Matrix stiffness regulates the protein profile of extracellular vesicles of pancreatic cancer cell lines
Ferrara, Bourgoin-Voillard, Habert et al
Proteomics (2024)
Cited by 7
AI Summary: OriGene’s rabbit polyclonal anti-tetraspanin 8 (TSPAN8) antibody (TA339425) was used in this study to detect and analyze extracellular vesicle proteins from pancreatic cancer cell lines, contributing to the investigation of how matrix stiffness affects EV protein profiles.
Snippet: … Primary rabbit monoclonal anti-CD9 (ab92726, 1:2000, Abcam, Cambridge, UK), rabbit polyclonal anti-tetraspanin 8 (TSPAN8) (TA339425, 1 µg/mL, Origene, Rockville, MD, USA) and murine monoclonal anti-basigin EMMPRIN/CD137 (B-5) (sc-46700, 1:200, Santa Cruz Biotechnology, Dallas, Texas, USA) antibodies were diluted in Blocking Buffer (Thermo Fisher Scientific, Waltham, MA, USA) and incubated at 4°C overnight. …
WB
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products