Fibroblast activation protein, alpha (FAP) Rabbit Polyclonal Antibody

CAT#: TA339416

Reviews ()
Write a review

Rabbit Polyclonal Anti-FAP Antibody



USD 475.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-FAP antibody is: synthetic peptide directed towards the C-terminal region of Human FAP. Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name fibroblast activation protein alpha
Background The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2014]
Synonyms DPPIV; FAPA; SIMP
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane
Frequently bought together (3)
Recombinant protein of human fibroblast activation protein, alpha (FAP)
    • 20 ug

USD 823.00


Transient overexpression lysate of fibroblast activation protein, alpha (FAP)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 186.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.