PFAS Rabbit Polyclonal Antibody

SKU TA339309

Rabbit Polyclonal Anti-PFAS Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PFAS antibody: synthetic peptide directed towards the N terminal of human PFAS. Synthetic peptide located within the following region: ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 145 kDa
• Gene Name: phosphoribosylformylglycinamidine synthase
• Database Link:
  NP_036525
  O15067
• Background: Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis. [provided by RefSeq, Jul 2008]
• Synonyms: FGAMS; FGAR-AT; FGARAT; PURL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 92%; Pig: 86%; Guinea pig: 86%; Bovine: 83%; Rabbit: 79%

Reference Data

• Protein Pathways: Metabolic pathways, Purine metabolism