OriGene Logo

CCDC19 (CFAP45) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339191
Rabbit Polyclonal Anti-CCDC19
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415833 Transient overexpression lysate of coiled-coil domain containing 19 (CCDC19) 100 ug
$665.00

View other "CCDC19 or NM_012337" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CCDC19 antibody: synthetic peptide directed towards the N terminal of human CCDC19. Synthetic peptide located within the following region: MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 66 kDa
Gene Name cilia and flagella associated protein 45
Database Link
Background The function remains unknown.
Synonyms CCDC19; NESG1
Note Immunogen Sequence Homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%; Yeast: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.