EME1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-EME1 antibody: synthetic peptide directed towards the middle region of human EME1. Synthetic peptide located within the following region: AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 63 kDa |
| Gene Name | essential meiotic structure-specific endonuclease 1 |
| Database Link | |
| Background | EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 (MIM 606591) form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication (Abraham et al., 2003 PubMed 14609959). supplied by OMIM |
| Synonyms | MMS4L; SLX2A |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 79% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Pathways | Homologous recombination |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
