TMEM168 Rabbit Polyclonal Antibody

CAT#: TA338609

Rabbit Polyclonal Anti-TMEM168 Antibody

Product Images

WB Suggested Anti-TMEM168 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM168 antibody: synthetic peptide directed towards the C terminal of human TMEM168. Synthetic peptide located within the following region: EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: transmembrane protein 168
• Database Link:
  NP_071929
  Entrez Gene 64418 Human
  UniProt ID Q9H0V1
• Background: TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.
• Synonyms: DKFZp564C012; FLJ13576
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane