HERPUD2 Rabbit Polyclonal Antibody

SKU TA338602

Rabbit Polyclonal Anti-HERPUD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HERPUD2 antibody: synthetic peptide directed towards the N terminal of human HERPUD2. Synthetic peptide located within the following region: MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: HERPUD family member 2
• Database Link:
  NP_071768
  Q9BSE4
• Background: HERPUD2 could be involved in the unfolded protein response (UPR) pathway.
• Synonyms: FLJ22313; FLJ31032
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane