OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ELOVL5 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338477
Rabbit Polyclonal Anti-ELOVL5 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY411911 Transient overexpression lysate of ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast) (ELOVL5) (as WB positive control) 100 ug
$436.00

View other "ELOVL5 or NM_021814" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name ELOVL fatty acid elongase 5
Database Link
Background ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 PubMed 10970790). supplied by OMIM. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011
Synonyms dJ483K16.1; HELO1; SCA38
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Pig: 92%; Goat: 92%; Bovine: 92%; Guinea pig: 85%; Horse: 79%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins, Nervous system: Neurodegenerative diseases
Protein Families Transmembrane
Protein Pathways Biosynthesis of unsaturated fatty acids
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Comparing Soy and Milk Protein Regulation of Hepatic Omega-3 Fatty Acid Biosynthesis
Gonzalez-Soto, Woods, MacLeod et al
FASEB J (2025) 39 (13), e70805 DOI: 10.1096/fj.202501283R
AI Summary: In this study, the OriGene ELOVL5 antibody (CAT#TA338477) was used for western blot analysis to assess hepatic ELOVL5 protein expression, helping to investigate the impact of soy versus milk protein diets on omega-3 fatty acid biosynthesis in mice.
Snippet: erwise indicated: FADS2 (CAT#28034‐1‐AP, ProteinTech, 1:250 dilution), FADS1 (CAT#126706, Abcam, 1:1000 dilution in 5% BSA), ELOVL2 (CAT#176327, Abcam, 1:1000 dilution), and ELOVL5 (CAT#TA338477, Origene, 1:500 dilution) for overnight incubation at 4°C. Membranes were washed in TBST and incubated in goat anti‐rabbit horseradish‐peroxidase‐conjugated secondary antibody (1:2000 dilution
FigureFigureFigure
WB
Investigating the Effects of Milk Protein Vs. Soy Protein on Omega3 Polyunsaturated Fatty Acid Metabolism and Energy Balance: Evidence from Preclinical and Clinical Models
Gonzalez Soto
Thesis (2025)
AI Summary: OriGene’s ELOVL5 antibody (CAT# TA338477) was used in this study to assess protein expression related to omega-3 polyunsaturated fatty acid metabolism.
Snippet: FADS1 (CAT#126706, Abcam, 1:1000 dilution in 5% BSA), ELOVL2 (CAT#176327, Abcam, 1:1000 dilution), and ELOVL5 (CAT#TA338477, Origene, 1:500 dilution) for overnight incubation at 4°C
Dietary EPA and DHA prevent changes in white adipose tissue omega-3 PUFA and oxylipin content associated with a Fads2 deficiency
Sarr, Payne, Hucik et al
J. Nutr. Biochem. (2019) 63, 140-149 DOI: 10.1016/j.jnutbio.2018.09.017
AI Summary: OriGene's ELOVL5 antibody (Catalog No. TA338477) was used in this study to detect ELOVL5 protein expression by immunoblotting, contributing to the analysis of fatty acid metabolism in mouse adipose tissue.
Snippet: … ab126706, 1:2000;Abcam, Cambridge, MA, USA), ELOVL2 (Catalog No. ab176327, 1:1000, Abcam) and ELOVL5 (Catalog No. TA338477, 1:500, Origene Technologies, Rockville, MD, USA). …
WB
Polyunsaturated fatty acid elongation and desaturation in activated human T cells: ELOVL5 is the key elongase
Robichaud, Munganyiki, Boilard et al
J. Lipid Res. (2018)
AI Summary: OriGene products contributed to this study by providing the ELOVL5 antibody (TA315700) for protein detection and the ELOVL5-targeting siRNA (SR311827) for gene knockdown experiments, enabling the authors to assess ELOVL5 expression and function in human T cells.
Snippet: Antibody against ELOVL5 (TA315700) was from OriGene Technologies (Rockville, MD), antibody against βTechno (A3854) was from Sigma-Aldrich The non-silencing negative control siRNA and the siRNA against ELOVL5 (SR311827) were from OriGene Technologies
Dietary EPA and DHA prevent changes in white adipose tissue omega-3 PUFA and oxylipin content associated with a Fads2 deficiency
Sarr, Payne, Hucik et al
The Journal of Nutritional Biochemistry (2018)
AI Summary: In this study, OriGene's ELOVL5 antibody (Catalog No. TA338477) was used to assess the expression of fatty acid elongase proteins in mouse tissues, contributing to the analysis of lipid metabolism changes associated with Fads2 deficiency and dietary interventions.
Snippet: … ab176327, 1:1000, Abcam) and ELOVL5 (Catalog No. TA338477, 1:500, Origene Technologies, Rockville, MD, USA). … ab176327, 1:1000, Abcam) and ELOVL5 (Catalog No. TA338477, 1:500, Origene Technologies, Inc., Rockville, MD, USA). …
WB
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products