Abo Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Abo antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GVEILSTFFGTLHPGFYSSSREAFTYERRPQSQAYIPWDRGDFYYGGAFF |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 39 kDa |
| Gene Name | ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase, transferase B, alpha 1-3-galactosyltransferase) |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | A3GALNT; A3GALT1; GTB; NAGAT |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins, Secreated Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.