OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLCN1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338391
Rabbit Polyclonal Anti-Clcn1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY424940 Transient overexpression lysate of chloride channel 1, skeletal muscle (CLCN1) (as WB positive control) 100 ug
$436.00

View other "CLCN1 or NM_000083" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse, Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Clcn1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 110 kDa
Gene Name chloride voltage-gated channel 1
Database Link
Background plays a role in chloride ion transport and membrane conductance in skeletal muscle RGD, Feb 2006. ##Evidence-Data-START## Transcript exon combination :: X62894.1, AY112740.1 ECO:0000332 RNAseq introns :: single sample supports all introns SRS369733, SRS369742 ECO:0000348 ##Evidence-Data-END##
Synonyms CLC1
Note Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Goat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products