OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LXR beta (NR1H2) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338112
Rabbit Polyclonal Anti-NR1H2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY402093 Transient overexpression lysate of nuclear receptor subfamily 1, group H, member 2 (NR1H2) (as WB positive control) 100 ug
$436.00
TP308381 Recombinant protein of human nuclear receptor subfamily 1, group H, member 2 (NR1H2), 20 µg
20 ug
$867.00

View other "LXR beta or NM_007121" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2. Synthetic peptide located within the following region: MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 51 kDa
Gene Name nuclear receptor subfamily 1 group H member 2
Database Link
Background The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 PubMed 19436111). supplied by OMIM, Jan 2010. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC047750.2, U07132.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025081, ERS025082 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms LXR-b; LXRB; NER; NER-I; RIP15; UNR
Note Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Dog: 86%; Pig: 83%; Mouse: 83%; Bovine: 83%; Rabbit: 83%; Guinea pig: 83%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products