OriGene Logo

CHRDL2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338064
Rabbit Polyclonal Anti-CHRDL2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414584 Transient overexpression lysate of chordin-like 2 (CHRDL2) 100 ug
$665.00
TP320245 Recombinant protein of human chordin-like 2 (CHRDL2), 20 µg
20 ug
$737.00

View other "CHRDL2 or NM_015424" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CHRDL2 antibody is: synthetic peptide directed towards the N-terminal region of Human CHRDL2. Synthetic peptide located within the following region: CTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 3 kDa
Gene Name chordin-like 2
Database Link
Background CHRDL2 is implicated in tumor angiogenesis. CHRDL2 may inhibits BMPs activity by blocking their interaction with their receptors. CHRDL2 has a negative regulator effect on the cartilage formation/regeneration from immature mesenchymal cells, by preventing or reducing the rate of matrix accumulation. CHRDL2 may play a role during myoblast and osteoblast differentiation, and maturation.
Synonyms BNF1; CHL2
Note Immunogen Sequence Homology: Human: 100%; Yeast: 90%; Mouse: 83%; Rat: 75%
Reference Data
Protein Categories Growth Factors, Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.