Dnase1l1 Rabbit Polyclonal Antibody

SKU TA337968

Rabbit Polyclonal Anti-Dnase1l1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Dnase1l1 antibody is: synthetic peptide directed towards the middle region of Mouse Dnase1l1. Synthetic peptide located within the following region: ADCASLTKKRLKSLLLRTKAGFHWVIPDGEDTTVRASTNCTYDRIVVHGQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: deoxyribonuclease 1-like 1
• Database Link:
  NP_081385
  Q9D7J6
• Background: The function of this protein remains unknown.
• Synonyms: DNAS1L1; DNASEX; DNL1L; OTTHUMP00000031940; OTTHUMP00000032113; XIB
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Mouse: 92%

Reference Data