RWDD4A (RWDD4) Rabbit Polyclonal Antibody

SKU TA337875

Rabbit Polyclonal Anti-RWDD4A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RWDD4A antibody: synthetic peptide directed towards the N terminal of human RWDD4A. Synthetic peptide located within the following region: MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEIS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: RWD domain containing 4
• Database Link:
  NP_689895
  Q6NW29
• Background: The specific function of this protein remains unknown.
• Synonyms: FAM28A; RWDD4A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Zebrafish: 77%

Reference Data