OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C22orf25 (TANGO2) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337860
Rabbit Polyclonal Anti-TANGO2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "C22orf25 or NM_152906" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TANGO2 antibody: synthetic peptide directed towards the N terminal of human TANGO2. Synthetic peptide located within the following region: MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name transport and golgi organization 2 homolog
Database Link
Background The exact functions of TANGO2 remain unknown.
Synonyms C22orf25; MECRCN
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 92%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Defects in lipid homeostasis reflect the function of TANGO2 in phospholipid and neutral lipid metabolism
Lujan, Foresti, Sugden et al
Elife (2023) 12 DOI: 10.7554/eLife.85345
AI Summary: OriGene products, specifically the TANGO2 Human cDNA ORF Clone (Cat# RC215041) and TANGO2 shRNA plasmid (Cat# TL319019), were used in this study to manipulate TANGO2 expression in cells, enabling the authors to investigate how TANGO2 deficiency disrupts lipid metabolism and contributes to disease phenotypes.
FigureFigureFigure
TANGO2 deficiency as a cause of neurodevelopmental delay with indirect effects on mitochondrial energy metabolism
Jennions, Hedberg-Oldfors, Berglund et al
J. Inherit. Metab. Dis. (2019)
AI Summary: OriGene’s anti-TANGO2 antibody (TA337860) was used in this study to investigate the cellular localization of the TANGO2 protein in patient-derived cells.
Snippet: scanned separately. Images were analysed using NIS-Elements AR 5.02 (Nikon) with cell identity blinded to the experimenter. Antibodies tested against TANGO2 were ab87576 (Abcam), ab182334 (Abcam) and TA337860 (Origene). RESULTS Genetics
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products