OriGene Logo

Erc2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337749
Rabbit Polyclonal Anti-Erc2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Erc2 or NM_177814" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Erc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Erc2. Synthetic peptide located within the following region: TQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQLSEGL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 115 kDa
Gene Name ELKS/RAB6-interacting/CAST family member 2
Database Link
Background Erc2 is rhought to be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. It seems to act together with BSN and may recruit liprin-alpha proteins to the CAZ.
Synonyms CAST; CAST1; ELKSL; KIAA0378; MGC133063; MGC133064; SPBC110; Spc110
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.