OriGene Logo

AGBL5 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA336018
Rabbit Polyclonal Anti-AGBL5 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY411897 Transient overexpression lysate of ATP/GTP binding protein-like 5 (AGBL5), transcript variant 1 100 ug
$665.00
TP317452 Recombinant protein of human ATP/GTP binding protein-like 5 (AGBL5), transcript variant 1, 20 µg
20 ug
$737.00

View other "AGBL5 or NM_001035507" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-AGBL5 Antibody: synthetic peptide directed towards the C terminal of human AGBL5. Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 47 kDa
Gene Name ATP/GTP binding protein-like 5
Database Link
Background AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.
Synonyms CCP5; RP75
Note Immunogen Sequence Homology: Human: 100%; Rat: 86%; Horse: 86%; Pig: 85%; Guinea pig: 85%; Mouse: 79%; Bovine: 79%
Reference Data
Protein Categories Cytokines, Enzyme: Peptidases, Intracellular Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.