TBC1D14 Rabbit Polyclonal Antibody

CAT#: TA335907

Rabbit Polyclonal Anti-TBC1D14 Antibody

Product Images

WB Suggested Anti-TBC1D14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TBC1D14 Antibody: synthetic peptide directed towards the N terminal of human TBC1D14. Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: TBC1 domain family member 14
• Database Link:
  NP_001106832
  Entrez Gene 57533 Human
  UniProt ID Q9P2M4
• Background: TBC1D14 may act as a GTPase-activating protein for Rab family protein(s).
• Synonyms: FLJ32400; KIAA1322
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%