ACSBG2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-ACSBG2 Antibody: synthetic peptide directed towards the middle region of human ACSBG2. Synthetic peptide located within the following region: LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 68 kDa |
| Gene Name | acyl-CoA synthetase bubblegum family member 2 |
| Database Link | |
| Background | ACSBG2 belongs to the ATP-dependent AMP-binding enzyme family, bubblegum subfamily.ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis. |
| Synonyms | BGR; BRGL; PRTD-NY3; PRTDNY3 |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Zebrafish: 92%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Dog: 85%; Mouse: 79% |
| Reference Data | |
| Protein Categories | Enzyme: Ligase, Intracellular Proteins, Membrane Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.