OriGene Logo

TRIM10 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA335675
Rabbit Polyclonal Anti-TRIM10 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY416423 Transient overexpression lysate of tripartite motif-containing 10 (TRIM10), transcript variant 1 100 ug
$665.00
TP310882 Recombinant protein of human tripartite motif-containing 10 (TRIM10), transcript variant 2, 20 µg
20 ug
$867.00

View other "TRIM10 or NM_006778" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TRIM10 Antibody: synthetic peptide directed towards the C terminal of human TRIM10. Synthetic peptide located within the following region: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name tripartite motif containing 10
Database Link
Background TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells.
Synonyms HERF1; RFB30; RNF9
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Rabbit: 90%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 79%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.