EFR3B Rabbit Polyclonal Antibody

SKU TA335605

Rabbit Polyclonal Anti-EFR3B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EFR3B Antibody is: synthetic peptide directed towards the N-terminal region of Human EFR3B. Synthetic peptide located within the following region: VPSLLFNLQHVEEAESRSPSPLQAPEKEKESPAELAERCLRELLGRAAFG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: EFR3 homolog B
• Database Link:
  NP_055786
  Q9Y2G0
• Background: The function of this protein remains unknown.
• Synonyms: KIAA0953
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data