DUS3L Rabbit Polyclonal Antibody

SKU TA335503

Rabbit Polyclonal Anti-DUS3L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DUS3L Antibody is: synthetic peptide directed towards the N-terminal region of Human DUS3L. Synthetic peptide located within the following region: GQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: dihydrouridine synthase 3 like
• Database Link:
  NP_064560
  Q96G46
• Background: DUS3L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
• Synonyms: DUS3
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%

Reference Data