DHRS12 Rabbit Polyclonal Antibody

SKU TA335464

Rabbit Polyclonal Anti-DHRS12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DHRS12 Antibody is: synthetic peptide directed towards the middle region of Human DHRS12. Synthetic peptide located within the following region: FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: dehydrogenase/reductase 12
• Database Link:
  NP_078981
  A0PJE2
• Background: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. Alternative splicing results in multiple transcript variants and protein isoforms.
• Synonyms: SDR40C1
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome