CLMN Rabbit Polyclonal Antibody

SKU TA335462

Rabbit Polyclonal Anti-CLMN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLMN Antibody: synthetic peptide directed towards the C terminal of human CLMN. Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 110 kDa
• Gene Name: calmin (calponin-like, transmembrane)
• Database Link:
  NP_079010
  Q96JQ2
• Background: CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.
• Synonyms: FLJ12383; FLJ43048; KIAA0500; KIAA1188
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 92%; Pig: 85%; Dog: 77%; Mouse: 77%; Bovine: 77%

Reference Data

• Protein Families: Transmembrane