Transmembrane Protein 175 (TMEM175) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-MGC4618 Antibody: synthetic peptide directed towards the N terminal of human MGC4618. Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 56 kDa |
| Gene Name | transmembrane protein 175 |
| Database Link | |
| Background | The MGC4618 is a hypothetical protein found in Chromosome 4. |
| Synonyms | hTMEM175 |
| Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Pig: 86%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
A growth-factor-activated lysosomal K+ channel regulates Parkinson's pathology
Wie, Liu, Song et al
Nature (2021)
Wie, Liu, Song et al
Nature (2021)
Cited by 122
AI Summary: In this study, the anti-TMEM175 antibody from OriGene (catalog no. TA335429) was used for immunoprecipitation experiments to investigate the role of the TMEM175 protein in lysosomal K+ channel function related to Parkinson's disease pathology.
Snippet: …sc-9996, for Extended Data Fig. 4e, used at 1:2,000 dilution for western blot), anti-TMEM175 (rabbit polyclonal, Proteintech, no. 19925-1-AP, for Figs. 1f, 3a, used at 1:1,000 for western blot), anti-TMEM175 (rabbit polyclonal, Origene, no. TA335429, for Fig. 3a, used at 2 μg ml−1 for immunoprecipitation), anti-Akt (rabbit polyclonal, Cell Signaling Technology, no. 9272, for Fig. 3d, Extended Data Fig. 2d, used at 1:1,000 dilution for western blot), anti-Pan AKT (mouse monoclonal, R&D Systems, no. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
