FAM83A Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-FAM83A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM83A. Synthetic peptide located within the following region: ANGRLSSSSGSASDRTSSNPFSGRSAGSHPVPESKQNKTKTKKQTTLWFL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 40 kDa |
| Gene Name | family with sequence similarity 83 member A |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | BJ-TSA-9 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Categories | Growth Factors, Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
FAM83A Promotes Lung Cancer Progression by Regulating the Wnt and Hippo Signaling Pathways and Indicates Poor Prognosis
Zheng, Li, Lei et al
Front Oncol (2020) 10, 180 DOI: 10.3389/fonc.2020.00180
Zheng, Li, Lei et al
Front Oncol (2020) 10, 180 DOI: 10.3389/fonc.2020.00180
Cited by 91
AI Summary: OriGene products, specifically the pCMV6-FAM83A plasmid and the control empty vector pCMV6, were used in this study to manipulate FAM83A expression in lung cancer cells, enabling the authors to investigate its role in cancer progression.
Snippet: 2 days. For transfection, cells were seeded in six-well plates 24 h before the experiment. The pCMV6-FAM83A plasmid and control empty vector pCMV6 were purchased from Origene (Rockville, MD, USA). Small interfering
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
