TMEM195(AGMO) Rabbit Polyclonal Antibody

CAT#: TA335317

Rabbit Polyclonal Anti-TMEM195 Antibody

 Product Datasheet for 'TA335317'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TMEM195 antibody: synthetic peptide directed towards the middle region of human TMEM195. Synthetic peptide located within the following region: AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 51 kDa
Gene Name alkylglycerol monooxygenase
Background TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
Synonyms TMEM195
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Zebrafish: 93%
Reference Data
Protein Families Transmembrane
Other products for "AGMO"
Frequently bought together (2)
Transient overexpression lysate of transmembrane protein 195 (TMEM195)
    • 100 ug

USD 315.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones