MCTP1 Rabbit Polyclonal Antibody

CAT#: TA335298

Rabbit Polyclonal Anti-Mctp1 Antibody

Product Images

Host: Rabbit; Target Name: Mctp1; Sample Tissue: Mouse Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mctp1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mctp1. Synthetic peptide located within the following region: LAARDRGGTSDPYVKFKIGRKEVFRSKIIHKNLNPVWEEKACVLIDHLRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: multiple C2 and transmembrane domain containing 1
• Database Link:
  NP_078993
  Entrez Gene 78771 Mouse
  UniProt ID Q6DN14
• Background: Mctp1 is a sugar transporter that specifically mediates the transport of UDP-xylose (UDP-Xyl) and UDP-N-acetylglucosamine (UDP-GlcNAc) from cytosol into Golgi.
• Synonyms: FLJ22344
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93%; Yeast: 83%

Reference Data

• Protein Families: Transmembrane