GADL1 Rabbit Polyclonal Antibody

SKU TA335108

Rabbit polyclonal Anti-GADL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GADL1 antibody: synthetic peptide directed towards the middle region of human GADL1. Synthetic peptide located within the following region: SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: glutamate decarboxylase like 1
• Database Link:
  NP_997242
  Q6ZQY3
• Background: The specific function of the protein remains unknown.
• Synonyms: ADC; CSADC; HuADC; HuCSADC
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome